allmonthweektoday populardaterelevant 1 something mildly uplifting i guess doveRetroFluff House 0:01:52 202 4976 2017-01-16 Favorite Share Remix 2 Rookie Mistake The Dude Tree3ZEKibbey 1 Other sampleuploadtemporarilydisabled 0:04:41 129 2291 2019-02-22 Favorite Share Remix 3 Stratus Inavon 1 Trance epicuplifting 0:05:03 196 2872 2018-01-31 Favorite Share Remix 4 Residue Inavon Trance epicklub affektuplifting 0:05:42 113 3205 2012-09-13 Favorite Share Remix 5 Fireflies (DubLion Remix) DubLion uncategorized simplicitychill 0:04:12 153 2457 2015-10-28 Favorite Share Remix 6 Amrum Snadbrugen Techno minimalupliftingneotrancemelodicdeephouse 0:06:53 110 1988 2014-09-22 Favorite Share Remix 7 UK DRILL PRT.2 INTRO LIKKLEDOTZ O.T.B ™(on fl) Trap drill 0:01:30 116 3740 2018-02-25 Favorite Share 8 depth (rmx) opaqity uncategorized randomgenreidksynthsrmxpercussionopaqityhappychillbit-tronmelodyoctopus200 0:04:17 121 2645 2014-10-25 Favorite Share Remix 9 amerie gets a lil funky mae's trex 2 uncategorized future funk 0:00:51 117 1214 2017-03-28 Favorite Share 10 Shirley was a Punk Rocker cripta Other funtributeedit 0:02:28 112 3915 2011-04-23 Favorite Share Remix 11 NEVER PISS A POET OFF po9t 1 Hip Hop xxxtentacionoffhardhiphopgangraptracklyricstraplilexperimentl808spidercloudpoetgroundbeatsoundspotifyunderdarkiedrakeyelldisstypemetalnascarmadpissnever 0:01:55 327 7753 2021-01-13 Favorite Share 12 White Lies - Tim Derry Remix Tim Derry Bass Music timderrybassdubstepodesza 0:04:04 184 2816 2016-06-12 Favorite Share Remix 13 blu po9t 1 Hip Hop peepdepressionradiobluerapwavvintagesoullofilyricstraplilxxxtentationblupoetchillbeatboyrnbvocaldynastytypesadshiloh 0:02:18 292 6300 2020-10-08 Favorite Share 14 Some Housy Demo for Newloops Vulkron House housenewloops 0:02:20 147 3736 2018-04-18 Favorite Share 15 Story of a Lifetime DubLion uncategorized just the beginning 0:03:39 133 2123 2015-10-10 Favorite Share 16 Overwhelmed po9tVulkron 2 Hip Hop vulkronpopyellowwoodpo9t 0:02:07 115 2031 2022-03-04 Favorite Share 17 Illusions (Griffen Eubanks Remix) Griffen Eubanks uncategorized remixgriffeneubanksskyroillusionsdubstepgriffene 0:04:18 206 4266 2013-01-09 Favorite Share 18 I'm still alive retro 1 Synthwave 0:01:11 150 3304 2019-10-10 Favorite Share Remix 19 Abstract. ▽Momo▽桃. 1 House experimental 0:01:52 166 3025 2020-08-25 Favorite Share 20 Savoca. ▽Momo▽桃. 4 Hip Hop trapvocaloid 0:02:08 138 1720 2021-05-12 Favorite Share 21 goodbye. swrlly 8 Future Bass love all of you guys 0:00:39 320 7565 2015-06-25 Favorite Share 22 変身 (ty for 1k followers!) rai. 1 Drum & Bass hybrid1000 0:03:23 117 1495 2021-11-25 Favorite Share Remix 23 16 On 16 MOOSEY ♪ 5 Hip Hop hiphopraptrap2021moosey 0:03:22 108 1650 2021-02-24 Favorite Share 24 Purple Planet Somnium [Wise Ed] uncategorized wubstephardstylegrowlwubwubextratonesynthambiencehardcorebig roomwubsheavy dubstepambientspeedcorepluckdubwub 0:03:58 123 1920 2015-07-23 Favorite Share Remix 25 Stardust Uprising uncategorized uprisingdubstep 0:04:24 285 5942 2013-02-26 Favorite Share 26 PO9T REMIX COMP 7 po9t 1 Acoustic snowcomphiphopukuleletraprnbpo9tremix 0:00:26 166 6966 2023-01-17 Favorite Share Remix 27 Audiotool Day 2013 - [The Results - Mixtape] Jacob Tyler 5 uncategorized competiton 0:20:28 126 1569 2013-11-11 Favorite Share 28 Big Room draft Theorist uncategorized 0:02:26 118 2094 2014-06-13 Favorite Share 29 po9t REMIX COMP 6 (stan cover) po9t 1 Newbie compeminemstanpo9tremix 0:02:03 142 3587 2022-09-12 Favorite Share Remix 30 Step Easy ( FT. Vocals by Griffin E. ) Uprising uncategorized griffen euprisinghybriddubstepglitchchill 0:04:20 158 3481 2012-11-02 Favorite Share Remix 31 Midnight Tokyo Uprising uncategorized electrohouseuprisingi thinkyoutellmenot sure 0:04:24 117 2733 2012-03-08 Favorite Share Remix 32 po9t REMIX CHALLENGE 5 po9t 1 Acoustic indiechallengefuckgregpoetpo9tremix 0:01:10 113 3508 2022-04-13 Favorite Share Remix