datepopular 1 ꜰᴀɴᴛᴀꜱʏ. L.O.E Ty Trap nexuscircleslucid 0:00:27 0 2 2023-01-29 Favorite Share 2 ꜰᴀɴᴛᴀꜱʏ. L.O.E Ty Trap nexuscircleslucid 0:02:55 1 5 2023-01-29 Favorite Share 3 summer of loneliness Era76 Hip Hop 0:02:14 2 5 2022-07-21 Favorite Share 4 River of Sorrows Ava Vail Drum & Bass liquid drum & bassliquid funk 0:05:08 3 48 2021-08-01 Favorite Share Remix 5 zora's domain. [vaporwave bump] ag. Experimental vibesidki suck at mixinglo fizeldatrash 0:02:33 12 60 2020-09-19 Favorite Share 6 ¡Despiértate! (w/ agbeatmaker) resol.ag. Lo-Fi boom bap9th wondersamplehip hopbump 0:02:14 25 179 2020-09-03 Favorite Share Remix 7 ꜰᴀɴᴛᴀꜱʏ. Nosleep gng Trap nexuscircleslucid 0:03:38 0 3 2020-08-26 Favorite Share Remix 8 the sixth station. ag. Lo-Fi deviate 0:01:51 13 80 2020-03-28 Favorite Share Remix 9 quick lo-fi beat mcord Newbie 0:01:46 0 2 2020-03-24 Favorite Share Remix 10 365 X JJ X CN x GA - Visions thatboijosh Trap nexuscircleslucid 0:03:11 1 14 2020-03-01 Favorite Share Remix 11 stars mcord Lo-Fi macpeeplofinightmillerlildarkvinylsademotional 0:03:00 1 18 2020-02-24 Favorite Share Remix 12 quick lo-fi beat mcord Newbie 0:01:46 1 5 2020-02-20 Favorite Share Remix 13 trap lil uzi type Nosleep gng Trap nexuscircleslucid 0:03:12 1 29 2020-02-04 Favorite Share Remix 14 S C X R F X C E Scxrfxce Trap 0:02:44 0 1 2019-12-21 Favorite Share 15 S C X R E F X C E Scxrfxce Trap 0:02:26 1 10 2019-12-21 Favorite Share 16 Tuwtol Amp7070 Lo-Fi 0:01:48 5 21 2019-12-14 Favorite Share Remix 17 ꜰᴀɴᴛᴀꜱʏ. SMOLDSNOAH Trap nexuscircleslucid 0:03:38 0 21 2019-11-28 Favorite Share Remix 18 THEONE2 marcusi419_whitefishschools_org Reggae 0:03:12 0 11 2019-11-20 Favorite Share 19 A Legends Legacy KB 24 Trap 0:03:11 2 27 2019-11-16 Favorite Share 20 smooth jolop25 Lo-Fi lofihip hopsadvibes 0:05:07 3 32 2019-11-14 Favorite Share Remix