allmonthweektoday populardaterelevant 1 Dawn in your hair tophat 10 Newbie tophat 0:07:52 216 10877 2013-07-13 Favorite Share Remix 2 Audiotool Day 2013 — TopHat tophat 7 uncategorized auditool daydiary 0:05:36 103 710 2013-11-18 Favorite Share Remix 3 So Long Ago tophat uncategorized tophatjacenostalgia 0:03:53 134 4435 2012-08-19 Favorite Share Remix 4 I tear them down (HatsOff Remix) tophat uncategorized julsyjace.tophat 0:04:08 119 3765 2012-12-09 Favorite Share Remix 5 Dad's tapes tophatOzWuOXBLUD[Khář¡]'Lewi Astroswrlly uncategorized diary 0:04:44 138 2458 2015-01-24 Favorite Share Remix 6 Family rue jue uncategorized rue juejacetophatjulsy 0:04:52 285 8393 2012-09-15 Favorite Share Remix 7 Games - Icebox & MoMo (ft. wvstend & breezy) Icebox▽Momo▽桃. 1 Bass Music momospeedrunleadenshrewbreezytrapcollabhybrid trapiceboxvocalsskrillextopthisbitchessssswvstendbwowheadbang 0:02:48 180 4269 2021-05-06 Favorite Share 8 Gone (EP is up for download!) Nitrix 5 uncategorized beautifulpeacefulnitrixorchestraldubstepmelodicgone 0:04:00 1322 38736 2013-06-17 Favorite Share 9 Genesis . Lewi Astro uncategorized trapblackugly 0:01:29 165 3739 2015-02-10 Favorite Share Remix 10 reminder opaqity uncategorized soay 2015 0:04:38 105 1581 2015-03-08 Favorite Share Remix 11 Fibration (HOME OFFICE) Audial 1 Techno darktech 0:04:47 147 3599 2020-06-04 Favorite Share 12 Residue Inavon Trance epicklub affektuplifting 0:05:42 113 3206 2012-09-13 Favorite Share Remix 13 Gravitate. synthonix EDM drumstep?meatyshitty breaksteriyaki chicken 0:01:19 516 16464 2016-11-24 Favorite Share Remix 14 Audiotool Day 2016 [Results] Jacob Tyler uncategorized competition 0:00:03 166 5933 2016-11-15 Favorite Share 15 Narnia po9t 1 Hip Hop hiphoppoplofitrappansexualpoetpo9t 0:02:17 132 3594 2022-08-19 Favorite Share 16 BGN {OVR VIP) Nominal 6 uncategorized futurebeatwitch housetrap 0:02:55 105 3631 2012-12-09 Favorite Share Remix 17 work out naswaltJBH 1 Rock naswaltrockvocalguitar 0:03:12 199 8119 2020-08-17 Favorite Share Remix 18 fired up (ft. XculE) okinXculE 1 EDM okinxculefired updubstep 0:02:48 228 12491 2020-03-01 Favorite Share 19 Audiotool Day 2020 Audiotool Day 1 Newbie atdayatdatd20 0:00:16 139 5730 2020-11-06 Favorite Share 20 Suave (remix contest) abstractproxima(desc if you care) Other sibilancea seriousproblem 0:01:40 162 2726 2013-09-08 Favorite Share Remix 21 figment nico 1 Indie chimeraplinth 0:03:54 108 1873 2023-01-16 Favorite Share Remix 22 Owl City - Fireflies (JD3 Cover) JD3 (NEW SONG!!!!) 2 Pop punkmetalguitarrockgaragefunsolorecording 0:04:12 116 1731 2021-11-10 Favorite Share 23 ICANN naswaltsim 1 Pop guitarsynthwavedarkdream pop 0:03:05 211 11268 2021-11-09 Favorite Share Remix 24 Audiotool Day 2013 - [The Results - Mixtape] Jacob Tyler 5 uncategorized competiton 0:20:28 126 1569 2013-11-11 Favorite Share 25 Audiotool Day 2015 Results Jacob Tyler uncategorized 0:00:13 184 5704 2015-11-10 Favorite Share 26 AT Day 2017 Competition [Prize Updated] Jacob Tyler uncategorized 2018deadlineatcompetitionday2017 0:03:39 111 1814 2017-12-12 Favorite Share Remix 27 SUPERTASK leadenshrewwithdecay 1 Other metalrock 0:04:25 135 2913 2023-09-30 Favorite Share 28 Lost In the Ocean (VIP) Icebox 1 Future Bass viplitofuturebassiceboxvocalsbublee 0:05:05 120 1206 2020-08-03 Favorite Share Remix 29 for him. hurakan 1 Ambient tributemulit-genrecinematicsynthwavedeepclient 0:04:42 123 3659 2023-03-24 Favorite Share 30 [RESULTS] You and I (Remix Competition) almate uncategorized remixcomp 0:01:36 127 2364 2016-04-27 Favorite Share Remix 31 National Bootyclub Day bootyclubnaswaltandysimpo9tHellforever (DOOMSHOP) 1 Pop bidenbootyclub 0:03:37 134 4555 2023-07-06 Favorite Share Remix 32 Year of the Sage (Torn) Uprising uncategorized uprisingdramatic. meloyelo. peotryoverthetopdeedledoo 0:05:07 119 1973 2012-03-28 Favorite Share Remix